Gimars 40 Packs XL Large Disposable Travel Toilet Seat Covers - Individually Wrapped Portable Non Slip Waterproof Potty Seat Covers for Adult,Kids and Toddler Potty Training,Owl Design
$25.98
Features
[Extra Large Design (24 * 25in) Fully Covers The Toilet Seat Which Prevent Child From Touching Any Part Of The Toilet] Big enough to drape over the front and sides of any shaped toilet so kids' bottom, legs, clothing, and hands do not touch public restrooms. Great for potty training and keeping little hands from gripping the sides of the public toilet seats when we have to use public restrooms.
[Individually Wrapped Compact for Travel & Easy Carrying] These 40 packs potty shields come in discreet, individually wrapped and easy to open pouches, which could easily carry in the car, purse, diaper bag, pocket for travel use. Gimars portable Potty Seat Covers are convenient for adults, the pregnant, the elderly and toddlers' potty training, with more sanitary in public places use.
[Improved PET Stickers Stay in Place with No Residue] Our disposable seat covers for toilets adapt high-quality and unique 2 sticky PET tabs, which are easy to stick at the bottom to keep them in place, especially for toilets with auto flushing. Besides, you can place the cover on the disposable toilet seat and it won't move! Strong adhesion allows you to not worry that the cover will tear or slip when you sit on it. NOTICE: NOT FLUSHABLE.
[30g Thicker Non-woven Surface and Waterproof Plastic PE Back] Our potty covers are made of two layers of premium fabric. The front side with a pattern is made of skin-friendly and ultra-soft cotton - no irritating skin. While the backing has a plastic-type coating so any wetness that may be on the toilet seat will not come through (to the part you sit on). They are thick enough to provide a barrier between me and the toilet seat.
[Cute Pattern with 40 Packs Choice &Buy with Confidence] Choice of 2 cute pattern owl and green dot designs that your kids will love. These 40 individually packed potty seat covers consist of 2 PE zipper bags each with 20 PCS. 2 PE zipper bags are packed in one PP bag. More hygienic outer packaging, don't worry about running out soon. If you have any issue with the products, we will try our best to provide satisfied service for you within hours.
Details
kgfrveedhygesufrusgpubresrms?kfurherhGmrs40PksXrgeDspsberveeSevers!urexr-rgedesgfuyversheese,prevegyurhdfrmuhgyprfhee.Whhebydrpeverhefrdsdesfyshpede,heseseverskeepkds'bms,egs,hg,dhdsedgerm-free.Perfefrpyrgdvdghedrededgrppubeses.
Wheyu'reheg,urdvduywrppedseversrempfrrvedesyrry.Ehpyshedmesdsree,esy--pepuh,mkghembreezesreyurr,purse,dperbg,rpke.GmrsprbePySeversreyveefrdusdheedery,busfrdderswhrehemdsfpyrg.D'mprmsehygeewheusgpubpes-hseGmrs!
Weudersdhemprefseverssygpe,espeywhedegwhu-fushges.h'swhyurdspsbeseversfeuremprvedPEskershsyfrmypewhresdueefbehd.Smpyskheverhebmdresssuredhw'mve.hesrgdhesesuresheverw'errspwheyus,prvdgyuwhwrry-freeresrmexperee.Peseehheseseversrefushbe.
urpyversredesgedwhyurmfrdpremd.Mdewh30ghker-wvesurfe,heseseversffersfdushedfee.hefrsde,feurguewdgreeddesgs,smdefsk-fredydur-sfmerhw'rreyursk.hewerprfpsPEbkprvdesbrrerbeweeyudheese,esurgweessseepshrughhepryus.SyedmfrbewhGmrs!
Wh40pkshsefrm,yu'everruufdspsbesevers.urpkgeudes2ueperps,wdgreeds,hyurkdswve.Ehpksssf20dvduypkedpysevers,wh2pksveeypkedehygeuerbg.eedwrryburugus!Pus,yurssfsurprry.fyuhveyssueswhurprdus,urdededemwprvdeprmpdssfryservewhhurs.
kehesepwrdseerdmrehygeresrmexperee.D'seefresswhemespregyursefdyurfmyfrmgerms.hseGmrs40PksXrgeDspsberveeSeversdejyhepeefmdhmeswhusgurpremum-quy,dvduywrppedpysheds.Buywhfdeedsrprrzgyurhygeedy!
:
Discover More Best Sellers in Potty Training
Shop Potty Training
Potty Training - POKANIC Toilet Potty Training Seat Cover, Travel Toilet Seat, Folding Non Slip Silicone Pads, Travel Portable Reusable Kids Toddlers Boys Girls, Carry Bag (Yellow - Duck)
Potty Training - 711tek Potty Seats for Toddlers & Kids - Toddler Potty Chair with Style and Comfort - Ideal Potty Training Toilet for Boys - Premium Toddler Toilet(White)
Potty Training - Disney Frozen Toddler Girls 7-PK Potty Training Pants With Success Tracking Chart and Stickers Sizes 2T, 3T, 4T
Potty Training - Daily Water Resistant Potty Training Watch Reminder- Long Battery Life Toilet Training Timer Watch Tool for Baby Toddlers Kids
Potty Training - One Proud Toddler Premium Travel Potty Seat – Compact, Non-Slip, Made in USA Seat, No-Pinch Locking Hinges, Easy to Clean, Includes Machine-Washable Carry Bag
Potty Training - Hello Bello Premium Training Pants Size 3T-4T I 22 Count of Disposeable, Gender Neutral, Eco-Friendly, and Potty Training Underwear with Snug and Comfort Fit for Toddlers on the Move I Li'l Barkers
Potty Training - Coco Melon 10-PK Toddler Potty Training Pants with Stickers and Success Tracking Chart in size 18M, 2T, 3T and 4T
BIG ELEPHANT Toddler Potty Training Pants Baby Boys Underwear
Potty Training - BIG ELEPHANT Toddler Potty Training Pants Baby Boys Underwear
Potty Training - The Honest Company Clean Conscious Training Pants | Plant-Based, Sustainable Diapers | Magical Moments + Butterfly Kisses | Size 2T/3T (34- lbs), 78 Count

